Regulation of heme biosynthesis in non-phototrophic bacteria.
نویسندگان
چکیده
The biosynthesis of tetrapyrroles like hemes and chlorophylls is essential for most living organisms. In bacteria hemes are integral parts of energy conserving electron transport chains and cofactors of various enzymes. Changes of environmental conditions usually lead to an adaption of the bacterial energy metabolism and often coincide with significant changes of cellular heme levels. This review focuses on the known regulatory mechanisms in non-phototrophic bacteria involved in the control of the formation of the heme biosynthetic apparatus. Species specific differences in the mode of energy generation result in various regulatory strategies. Focusing on the well investigated bacteria Bacillus subtilis, Escherichia coli, Pseudomonas aeruginosa, and Salmonella typhimurium the involved environmental stimuli, employed transcriptional regulators and promoter structures as well as the role of protein stability are described. Broad variations of the used regulatory principles were observed.
منابع مشابه
Farnesyl diphosphate synthase gene of three phototrophic bacteria and its use as a phylogenetic marker.
Farnesyl diphosphate (FPP) synthase is essential not only for phototrophic bacteria in carotenoid biosynthesis, but also for non-phototrophic bacteria in the biosynthesis of physiologically important compounds. The gene encoding FPP synthase was assessed as a molecular marker to investigate the intermingled relationship between the phototropic and non-phototropic bacteria in the alpha-Proteobac...
متن کاملTranscriptome analysis of the Rhodobacter sphaeroides PpsR regulon: PpsR as a master regulator of photosystem development.
PpsR from the anoxygenic phototrophic bacterium Rhodobacter sphaeroides has been known as an oxygen- and light-dependent repressor of bacteriochlorophyll and carotenoid biosynthesis genes and puc operons involved in photosystem development. However, the putative PpsR-binding sites, TGTN12ACA, are also located upstream of numerous nonphotosystem genes, thus raising the possibility that the role ...
متن کاملThe effect of water borne nickel on iron metabolism and heme biosynthesis in common carp (Cyprinus carpio)
Nickel is an essential element for all living organisms such as microorganisms, plants and animals. When nickel concentration exceeds the necessary concentration, could be toxic, and likewise causes adverse effects in living organisms. In this study, following determining nickel LC50-96h for common carp (Cyprinus carpio), nickel sub-lethal treatments including 0 (control), 0.055, 0.275, 0.572, ...
متن کاملCell biology and molecular basis of denitrification.
Denitrification is a distinct means of energy conservation, making use of N oxides as terminal electron acceptors for cellular bioenergetics under anaerobic, microaerophilic, and occasionally aerobic conditions. The process is an essential branch of the global N cycle, reversing dinitrogen fixation, and is associated with chemolithotrophic, phototrophic, diazotrophic, or organotrophic metabolis...
متن کاملCovalent structure of the diheme cytochrome subunit and amino-terminal sequence of the flavoprotein subunit of flavocytochrome c from Chromatium vinosum.
The complete sequence of the 21-kDa cytochrome subunit of the flavocytochrome c (FC) from the purple phototrophic bacterium Chromatium vinosum has been determined to be as follows: EPTAEMLTNNCAGCHG THGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIAS TIMGRIAKGYSTADFEKMAGYFKQQTYQPAKQSF DTALADTGAKLHDKYCEKCHVEGGKPLADEEDY HILAGQWTPYLQYAMSDFREERRPMEKKMASKL RELLKAEGDAGLDALFAFYASQQ. The sequence is the first example o...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
عنوان ژورنال:
- Journal of molecular microbiology and biotechnology
دوره 4 3 شماره
صفحات -
تاریخ انتشار 2002